Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2DL2, Human (HEK293, His)

NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NKG2DL2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2dl2-protein-human-hek-293-his.html

Purity

96.00

Smiles

GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Molecular Formula

80328 (Gene_ID) Q9BZM5 (G26-S217) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1760706 1.0 µg DNA

PUM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LCP1 Antibody, HRP conjugated
CSB-PA012824YB01HU-01 50 µg

LCP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
LCP1 Antibody, HRP conjugated
CSB-PA012824YB01HU-02 100 µg

LCP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Type I 4-phosphatase (h) -PR
sc-44177-PR 10 µM - 20 µL

Type I 4-phosphatase (h) -PR

Sign In for Pricing
View Details
MYL9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
31260064 1.0 µg DNA

MYL9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PAICS Antibody
orb521337-01 50 μL

PAICS Antibody

Sign In for Pricing
View Details