Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf13 Rabbit Polyclonal Antibody (Biotin)

C5orf13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P311, PTZ17, SEZ17, D4S114, C5orf13, PRO1873

UniProt

Q16612

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REDETRTQRSRMTDRVPCSKCFQVYYPELFVWVSQEPFPNKDMEGRLPKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001135946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr379 sgRNA CRISPR Lentivector set (Rat)
K7193301 3x 1.0 µg

Olr379 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DiagNano™ Carboxyl Porous Silica Particles, 5 μm, 40 A Pore Size
DEIABL255-01 5 g

DiagNano™ Carboxyl Porous Silica Particles, 5 μm, 40 A Pore Size

Sign In for Pricing
View Details
DiagNano™ Carboxyl Porous Silica Particles, 5 μm, 40 A Pore Size
DEIABL255-02 96T

DiagNano™ Carboxyl Porous Silica Particles, 5 μm, 40 A Pore Size

Sign In for Pricing
View Details
N- (3-Amino-2-methylphenyl) benzenesulfonamide
BMB27054-01 50 mg

N- (3-Amino-2-methylphenyl) benzenesulfonamide

Sign In for Pricing
View Details
N- (3-Amino-2-methylphenyl) benzenesulfonamide
BMB27054-02 0.5 g

N- (3-Amino-2-methylphenyl) benzenesulfonamide

Sign In for Pricing
View Details
OVCH1 siRNA (h)
sc-96249 10 µM

OVCH1 siRNA (h)

Sign In for Pricing
View Details