Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf13 Rabbit Polyclonal Antibody (Biotin)

C5orf13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P311, PTZ17, SEZ17, D4S114, C5orf13, PRO1873

UniProt

Q16612

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REDETRTQRSRMTDRVPCSKCFQVYYPELFVWVSQEPFPNKDMEGRLPKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001135946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 Rabbit Polyclonal Antibody (PE)
orb2581299 100 µg

SOX9 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
(S)-3-Isopropylamino-1,2-propanediol
Q-1515.0001 1.0g

(S)-3-Isopropylamino-1,2-propanediol

Sign In for Pricing
View Details
STAT3 (NM_213662) Human Untagged Clone
SC100105 10 µg

STAT3 (NM_213662) Human Untagged Clone

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)
MBS2137837-01 0.1 mL

Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)
MBS2137837-02 0.2 mL

Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)
MBS2137837-03 0.5 mL

Biotin Linked Monoclonal Antibody to Alpha2Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details