Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf13 Rabbit Polyclonal Antibody (HRP)

C5orf13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P311, PTZ17, SEZ17, D4S114, C5orf13, PRO1873

UniProt

Q16612

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REDETRTQRSRMTDRVPCSKCFQVYYPELFVWVSQEPFPNKDMEGRLPKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001135946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Legionella pneumophila (MaxLight 650) discontinued
227053-ML650 100 µL

Legionella pneumophila (MaxLight 650) discontinued

Sign In for Pricing
View Details
Research Grade Anti-Human CD172a/SIRPA (AL008)
DHF64004 100 μg

Research Grade Anti-Human CD172a/SIRPA (AL008)

Sign In for Pricing
View Details
HMGA2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2557566 100 µL

HMGA2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
CASP16 (CASP16P) Human qPCR Template Standard (XM_113871)
HK212653 1 Kit

CASP16 (CASP16P) Human qPCR Template Standard (XM_113871)

Sign In for Pricing
View Details
Myf-5 (C-11)
sc-518144 200 µg/mL

Myf-5 (C-11)

Sign In for Pricing
View Details
Nori® Salmon TNFRI ELISA Kit
GR202030 96 Well

Nori® Salmon TNFRI ELISA Kit

Sign In for Pricing
View Details