Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ino80b Rabbit Polyclonal Antibody (HRP)

Ino80b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, Znhi, Hmga1, Papa1, HMG1YL, Znhit4, HMG1YL4, Hmga1l4, 2510009I23Rik

UniProt

Q99PT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076036

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanine 3.5 azide [equivalent to Cy3.5® azide]
980-AAT 1 mg

Cyanine 3.5 azide [equivalent to Cy3.5® azide]

Sign In for Pricing
View Details
CF®680-Dextran 70,000 MW, Anionic and Fixable
#80129 1x 1 mg

CF®680-Dextran 70,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
rac 2-(4-Formylphenyl)propionic Acid(Ibuprofen Impurity K)
TRC-F700900-10MG 10 mg

rac 2-(4-Formylphenyl)propionic Acid(Ibuprofen Impurity K)

Sign In for Pricing
View Details
Human Umbilical Cord Mesenchymal Stem Cells
SC00A1 500000 Cells

Human Umbilical Cord Mesenchymal Stem Cells

Sign In for Pricing
View Details
Sambucus nigra -SNA-I- Immobilized Lectin
AK-6802-2 2 mL

Sambucus nigra -SNA-I- Immobilized Lectin

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS710631 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details