Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD11 Rabbit Polyclonal Antibody (Biotin)

ABHD11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP1226, WBSCR21

UniProt

Q8NFV4

Immunogen

The immunogen for Anti-ABHD11 antibody is: synthetic peptide directed towards the N-terminal region of Human ABHDB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine A2a Receptor Blocking Peptide
CBP1023-01 1 mg

Adenosine A2a Receptor Blocking Peptide

Sign In for Pricing
View Details
Adenosine A2a Receptor Blocking Peptide
CBP1023-02 5 mg

Adenosine A2a Receptor Blocking Peptide

Sign In for Pricing
View Details
Anti-BC2 tag (Recombinant Mouse, Monoclonal, VHH-mFc)
A133862 100 µL

Anti-BC2 tag (Recombinant Mouse, Monoclonal, VHH-mFc)

Sign In for Pricing
View Details
Paraoxonase-1 (PON1, PON) (MaxLight 650)
MBS6444399-01 0.1 mL

Paraoxonase-1 (PON1, PON) (MaxLight 650)

Sign In for Pricing
View Details
Paraoxonase-1 (PON1, PON) (MaxLight 650)
MBS6444399-02 5x 0.1 mL

Paraoxonase-1 (PON1, PON) (MaxLight 650)

Sign In for Pricing
View Details
Human BET1 shRNA Plasmid
abx956963-01 150 µg

Human BET1 shRNA Plasmid

Sign In for Pricing
View Details