Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB33B Rabbit Polyclonal Antibody (Biotin)

RAB33B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SMC2

UniProt

Q9H082

Immunogen

The immunogen for Anti-RAB33B antibody is: synthetic peptide directed towards the C-terminal region of Human RB33B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTL

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112586.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated
orb3008824-01 20 µg

Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated
orb3008824-02 100 µg

Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated
orb3008824-03 1 mg

Recombinant Human Zinc finger protein basonuclin-1 (BNC1), partial, Biotinylated

Sign In for Pricing
View Details
Rat Monoclonal Integrin beta 4/CD104 Antibody (308601) [Janelia Fluor 635]
FAB4054JF635 0.1 mL

Rat Monoclonal Integrin beta 4/CD104 Antibody (308601) [Janelia Fluor 635]

Sign In for Pricing
View Details
KIF4CP ORF Vector (Human) (pORF)
ORF022272 1.0 µg DNA

KIF4CP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Heartworm, Canine (Dirofilaria immitis, D. immitis) (MaxLight 550)
H1830-01B-ML550 100 µL

Heartworm, Canine (Dirofilaria immitis, D. immitis) (MaxLight 550)

Sign In for Pricing
View Details