Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB33B Rabbit Polyclonal Antibody (FITC)

RAB33B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMC2

UniProt

Q9H082

Immunogen

The immunogen for Anti-RAB33B antibody is: synthetic peptide directed towards the C-terminal region of Human RB33B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTL

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112586.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MVP Rabbit Monoclonal Antibody
MA3835-.1 100 µL

Anti-MVP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Polyclonal RIPK1 antibody - middle region
APR01895G 0.05mg

Polyclonal RIPK1 antibody - middle region

Sign In for Pricing
View Details
Express Cloning Checker Kit I
K5011200 200 Reactions

Express Cloning Checker Kit I

Sign In for Pricing
View Details
Env Antibody
orb843130 2 mg

Env Antibody

Sign In for Pricing
View Details
Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit
EKL57199 96 Tests

Human Receptor II For The Fc Region Of Immunoglobulin G (FcgRII) ELISA Kit

Sign In for Pricing
View Details
TE-1 GFP Reporter Cell Line
ABC-RC144H 1 Vial

TE-1 GFP Reporter Cell Line

Sign In for Pricing
View Details