Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB33B Rabbit Polyclonal Antibody (FITC)

RAB33B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMC2

UniProt

Q9H082

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit
MBS2515467-01 24 Tests

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit

Sign In for Pricing
View Details
Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit
MBS2515467-02 48 Test

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit

Sign In for Pricing
View Details
Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit
MBS2515467-03 96 Tests

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit

Sign In for Pricing
View Details
Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit
MBS2515467-04 5x 96 Tests

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit

Sign In for Pricing
View Details
Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit
MBS2515467-05 10x 96 Tests

Monkey CKLFSF8 (Chemokine Like Factor Superfamily 8) ELISA Kit

Sign In for Pricing
View Details
Human NXT2 activation kit by CRISPRa
GA111060 1 Kit

Human NXT2 activation kit by CRISPRa

Sign In for Pricing
View Details