Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Krtap3-3 Rabbit Polyclonal Antibody (FITC)

Krtap3-3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KAP3, KRTAP, KAP3.3, KRTAP3.3, 2310020D06Rik

UniProt

Q9D7P0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_079800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BEN domain-containing protein 7, BEND7 ELISA Kit
MBS9322464-01 48 Well

Human BEN domain-containing protein 7, BEND7 ELISA Kit

Sign In for Pricing
View Details
Human BEN domain-containing protein 7, BEND7 ELISA Kit
MBS9322464-02 96 Well

Human BEN domain-containing protein 7, BEND7 ELISA Kit

Sign In for Pricing
View Details
Human BEN domain-containing protein 7, BEND7 ELISA Kit
MBS9322464-03 5x 96 Well

Human BEN domain-containing protein 7, BEND7 ELISA Kit

Sign In for Pricing
View Details
Human BEN domain-containing protein 7, BEND7 ELISA Kit
MBS9322464-04 10x 96 Well

Human BEN domain-containing protein 7, BEND7 ELISA Kit

Sign In for Pricing
View Details
SLC35E2 siRNA (Human)
orb1861607-01 15 nmol

SLC35E2 siRNA (Human)

Sign In for Pricing
View Details
SLC35E2 siRNA (Human)
orb1861607-02 30 nmol

SLC35E2 siRNA (Human)

Sign In for Pricing
View Details