Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gfm1 Rabbit Polyclonal Antibody (HRP)

Gfm1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gfm, AW545374, D3Wsu133, D3Wsu133e

UniProt

Q8K0D5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_613057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM STORM CF®568 Antibody Labeling Kit, 1x50ug labeling
#92550 1 Kit

Mix-n-StainTM STORM CF®568 Antibody Labeling Kit, 1x50ug labeling

Sign In for Pricing
View Details
CCPG1 Human Gene Knockout Kit (CRISPR)
KN423087 1 Kit

CCPG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C17orf76 (LRRC75A) activation kit by CRISPRa
GA117947 1 Kit

Human C17orf76 (LRRC75A) activation kit by CRISPRa

Sign In for Pricing
View Details
(-)-Alpha-Kainic Acid Monohydrate
TRC-K445000-5MG 5 mg

(-)-Alpha-Kainic Acid Monohydrate

Sign In for Pricing
View Details
Nucleostemin Recombinant Rabbit Monoclonal Antibody [JG37-82]
ET7108-55 100 µL

Nucleostemin Recombinant Rabbit Monoclonal Antibody [JG37-82]

Sign In for Pricing
View Details
Rac1/CDC42 (Ab-71) Antibody
8B7205-AAT 50 µg

Rac1/CDC42 (Ab-71) Antibody

Sign In for Pricing
View Details