Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gfm1 Rabbit Polyclonal Antibody (HRP)

Gfm1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gfm, AW545374, D3Wsu133, D3Wsu133e

UniProt

Q8K0D5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_613057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-Human IgD Antibody
RC-16441-01 50 μL

Recombinant Anti-Human IgD Antibody

Sign In for Pricing
View Details
Recombinant Anti-Human IgD Antibody
RC-16441-02 100 µL

Recombinant Anti-Human IgD Antibody

Sign In for Pricing
View Details
Recombinant Anti-Human IgD Antibody
RC-16441-03 1 mL

Recombinant Anti-Human IgD Antibody

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), 1mg/mL
BNUM2173-50 1x 50 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), 1mg/mL

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF405S conjugate, 0.1mg/mL
BNC042796-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERp57 (PDIA3) Goat Polyclonal Antibody
AB0003-200 400 µg

ERp57 (PDIA3) Goat Polyclonal Antibody

Sign In for Pricing
View Details