Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gfm1 Rabbit Polyclonal Antibody (FITC)

Gfm1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gfm, AW545374, D3Wsu133, D3Wsu133e

UniProt

Q8K0D5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_613057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), 0.2mg/mL
BNUB1736-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), 0.2mg/mL

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (rAE-4), CF594 conjugate, 0.1mg/mL
BNC943518-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPSE2 Human Gene Knockout Kit (CRISPR)
KN416534 1 Kit

HPSE2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Sophora japonica (Pagoda Tree) -SJA-
L-2901-5 25 mg

Pure Sophora japonica (Pagoda Tree) -SJA-

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), 0.2mg/mL
BNUB2939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), 0.2mg/mL

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF594 conjugate, 0.1mg/mL
BNC941961-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details