Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Rabbit Polyclonal Antibody (HRP)

TSLP Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q969D9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_149024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SH3BP5
P9196-01 50 µg

Recombinant Human SH3BP5

Sign In for Pricing
View Details
Recombinant Human SH3BP5
P9196-02 200 µg

Recombinant Human SH3BP5

Sign In for Pricing
View Details
Recombinant Human SH3BP5
P9196-03 1 mg

Recombinant Human SH3BP5

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 12 CLIA Kit
MBS8426388-01 1 Kit

Mouse Matrix Metalloproteinase 12 CLIA Kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 12 CLIA Kit
MBS8426388-02 5x 1 Kit

Mouse Matrix Metalloproteinase 12 CLIA Kit

Sign In for Pricing
View Details
Lentiviral mouse Insl6 shRNA (UAS) - Lentiviral mouse Insl6 shRNA (UAS, RFP) plasmid
GTR15182725 1 Vial

Lentiviral mouse Insl6 shRNA (UAS) - Lentiviral mouse Insl6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details