Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Whsc2 Rabbit Polyclonal Antibody (FITC)

Whsc2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Nel, Whsc, Whsc2, Whsc2h

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_036044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Urah shRNA (UAS) - Lentiviral mouse Urah shRNA (UAS, RFP) (100)
GTR15168468 1 Vial

Lentiviral mouse Urah shRNA (UAS) - Lentiviral mouse Urah shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Streptomyces lividans DNA-binding protein HU 1
MBS9421013-01 0.02 mg

Recombinant Streptomyces lividans DNA-binding protein HU 1

Sign In for Pricing
View Details
Recombinant Streptomyces lividans DNA-binding protein HU 1
MBS9421013-02 0.1 mg

Recombinant Streptomyces lividans DNA-binding protein HU 1

Sign In for Pricing
View Details
Recombinant Streptomyces lividans DNA-binding protein HU 1
MBS9421013-03 1 mg

Recombinant Streptomyces lividans DNA-binding protein HU 1

Sign In for Pricing
View Details
Recombinant Streptomyces lividans DNA-binding protein HU 1
MBS9421013-04 5x 1 mg

Recombinant Streptomyces lividans DNA-binding protein HU 1

Sign In for Pricing
View Details
Dnaaf2 ORF Vector (Rat) (pORF)
ORF066088 1.0 µg DNA

Dnaaf2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details