Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSS Rabbit Polyclonal Antibody (FITC)

CTSS Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P25774

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CATS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGI

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (MaxLight 490)
MBS6413599-01 0.1 mL

DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (MaxLight 490)

Sign In for Pricing
View Details
DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (MaxLight 490)
MBS6413599-02 5x 0.1 mL

DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (MaxLight 490)

Sign In for Pricing
View Details
N-[2- (N-Vinylbenzylamino) ethyl]-3-aminopropyltrimethoxysilane Hydrochloride (30-40% in Methanol)
OR1077708 25 mL

N-[2- (N-Vinylbenzylamino) ethyl]-3-aminopropyltrimethoxysilane Hydrochloride (30-40% in Methanol)

Sign In for Pricing
View Details
ACC Synthase Like Protein 1 (PHACS) Antibody
abx236369 100 µg

ACC Synthase Like Protein 1 (PHACS) Antibody

Sign In for Pricing
View Details
pEGFP-PABPN1 Plasmid
PVT14255 2 µg

pEGFP-PABPN1 Plasmid

Sign In for Pricing
View Details
LMOD1 (Leiomodin 1, Leiomodin-1, 64kD Autoantigen 1D, 64kD Autoantigen 1D3, 64kD Autoantigen D1, FLJ55689, Leiomodin Muscle Form, Smooth Muscle Leiomodin, SM-Lmod, Thyroid-associated Ophthalmopathy Autoantigen) (MaxLight 750) discontinued
129146-ML750 100 µL

LMOD1 (Leiomodin 1, Leiomodin-1, 64kD Autoantigen 1D, 64kD Autoantigen 1D3, 64kD Autoantigen D1, FLJ55689, Leiomodin Muscle Form, Smooth Muscle Leiomodin, SM-Lmod, Thyroid-associated Ophthalmopathy Autoantigen) (MaxLight 750) discontinued

Sign In for Pricing
View Details