Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pip5k1a Rabbit Polyclonal Antibody (FITC)

Pip5k1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pi, Pipk5a, PI4P5K-I[a], PIP5KIalpha, PIP5K1-alpha

UniProt

P70182

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CEACAM3/CD66d Antibody [mFluor Violet 450 SE]
NBP2-99909MFV450 0.1 mL

Rabbit Polyclonal CEACAM3/CD66d Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
OR11J7P 3'UTR Lenti-reporter-Luc Vector
34941081 1.0 µg

OR11J7P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DARS Protein Lysate (Rat) with C-HA Tag
17664036 100 µg

DARS Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
SNAI2 protein
80R-4216 100 ug

SNAI2 protein

Sign In for Pricing
View Details
SIM1 Human Over-expression Lysate
orb1346330 100 µg

SIM1 Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLC22A3 knockout cell line
ABC-KH13935 1 Vial

Human SLC22A3 knockout cell line

Sign In for Pricing
View Details