Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pip5k1a Rabbit Polyclonal Antibody (FITC)

Pip5k1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pi, Pipk5a, PI4P5K-I[a], PIP5KIalpha, PIP5K1-alpha

UniProt

P70182

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NPAS4 Antibody
MBS9233432-01 0.1 mL

Anti-NPAS4 Antibody

Sign In for Pricing
View Details
Anti-NPAS4 Antibody
MBS9233432-02 5x 0.1 mL

Anti-NPAS4 Antibody

Sign In for Pricing
View Details
Anti-EPDR1 Antibody Picoband® FITC Conjugated
A12195-1-FITC 100 µg/Vial

Anti-EPDR1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
CSF2 (Granulocyte-Macrophage Colony-Stimulating Factor, Colony Stimulating Factor 2)
312144-01 50 µL

CSF2 (Granulocyte-Macrophage Colony-Stimulating Factor, Colony Stimulating Factor 2)

Sign In for Pricing
View Details
CSF2 (Granulocyte-Macrophage Colony-Stimulating Factor, Colony Stimulating Factor 2)
312144-02 100 µL

CSF2 (Granulocyte-Macrophage Colony-Stimulating Factor, Colony Stimulating Factor 2)

Sign In for Pricing
View Details
HIV-1 Gag p24 Recombinant Protein
orb1671261 0.1 mg

HIV-1 Gag p24 Recombinant Protein

Sign In for Pricing
View Details