Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pip5k1a Rabbit Polyclonal Antibody (HRP)

Pip5k1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pi, Pipk5a, PI4P5K-I[a], PIP5KIalpha, PIP5K1-alpha

UniProt

P70182

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), Biotin conjugate, 0.1mg/mL
BNCB2241-500 1x 500 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-(+)-Malic Acid
TRC-M159500-250G 250 g

D-(+)-Malic Acid

Sign In for Pricing
View Details
LRP6 (NM_002336) Human Over-expression Lysate
LY419396 100 µg

LRP6 (NM_002336) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF740 conjugate, 0.1mg/mL
BNC741660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABIN3 (TNIP3) (C-term) Rabbit Polyclonal Antibody
AP23892PU-N 50 µg

ABIN3 (TNIP3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMPK2 (NM_207315) Human Recombinant Protein
TP318794 20 µg

CMPK2 (NM_207315) Human Recombinant Protein

Sign In for Pricing
View Details