Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPO Rabbit Polyclonal Antibody (FITC)

MPO Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P05164

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MPO

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF647 conjugate, 0.1mg/mL
BNC471505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701596 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Rabbit IgG,
AA-2307-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Rabbit IgG,

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), 0.2mg/mL
BNUB0732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), 0.2mg/mL

Sign In for Pricing
View Details
HES3 (NM_001024598) Human Over-expression Lysate
LY422515 100 µg

HES3 (NM_001024598) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS704110 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details