Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H3A Rabbit Polyclonal Antibody (HRP)

HIST1H3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A

UniProt

P68431

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HIST1H3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003520

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ORP150/HSP12A Protein (His Tag)
PKSH032553-01 10 µg

Recombinant Human ORP150/HSP12A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ORP150/HSP12A Protein (His Tag)
PKSH032553-02 50 µg

Recombinant Human ORP150/HSP12A Protein (His Tag)

Sign In for Pricing
View Details
Xanthine Oxidase Microplate Assay Kit
RDSM056 100 Assays

Xanthine Oxidase Microplate Assay Kit

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-01 50 μL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-02 100 µL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details
Recombinant GOT1 Antibody
RC-4153-03 1 mL

Recombinant GOT1 Antibody

Sign In for Pricing
View Details