Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hist2h4 Rabbit Polyclonal Antibody (Biotin)

Hist2h4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H4, H4c1, H4c2, H4c3, H4c4, H4c6, H4c8, H4c9, H4c11, H4c12, H4f16, Hist2, X04652, Hist2h4

UniProt

P62806

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_291074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-01 0.02 mg (E-Coli)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details
Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-02 0.1 mg (E-Coli)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details
Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-03 0.02 mg (Yeast)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details
Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-04 0.1 mg (Yeast)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details
Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-05 0.02 mg (Baculovirus)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details
Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)
MBS1405828-06 1 mg (E-Coli)

Recombinant Rickettsia felis UPF0369 protein RF_1112 (RF_1112)

Sign In for Pricing
View Details