Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Casp3 Rabbit Polyclonal Antibody (Biotin)

Casp3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ya, AC-, CC3, CPP, mld, AC-3, Casp, Lice, Yama, mldy, CPP32, SCA-1, CASP-3, CPP-32, Caspase-3, A830040C14Rik

UniProt

P70677

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_033940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus / Rhesus macaque TL1A Protein, His Tag
orb1496224-01 1 mg

Cynomolgus / Rhesus macaque TL1A Protein, His Tag

Sign In for Pricing
View Details
Cynomolgus / Rhesus macaque TL1A Protein, His Tag
orb1496224-02 100 µg

Cynomolgus / Rhesus macaque TL1A Protein, His Tag

Sign In for Pricing
View Details
PHC1 Knockout Hela Polyclonal Cells
ARG8951 1 Million

PHC1 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)
MBS967939-01 0.02 mg (E-Coli)

Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)

Sign In for Pricing
View Details
Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)
MBS967939-02 0.02 mg (Yeast)

Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)

Sign In for Pricing
View Details
Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)
MBS967939-03 0.1 mg (E-Coli)

Recombinant Mouse Vacuolar protein sorting-associated protein 26A (Vps26a)

Sign In for Pricing
View Details