Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Rabbit Polyclonal Antibody (HRP)

CCS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC12A5, NT (SLC12A5, KCC2, KIAA1176, Solute carrier family 12 member 5, Electroneutral potassium-chloride cotransporter 2, K-Cl cotransporter 2, Neuronal K-Cl cotransporter) (MaxLight 750) discontinued
041792-ML750 100 µL

SLC12A5, NT (SLC12A5, KCC2, KIAA1176, Solute carrier family 12 member 5, Electroneutral potassium-chloride cotransporter 2, K-Cl cotransporter 2, Neuronal K-Cl cotransporter) (MaxLight 750) discontinued

Sign In for Pricing
View Details
COMMD3 Antibody Blocking peptide
orb1444999 500 µg

COMMD3 Antibody Blocking peptide

Sign In for Pricing
View Details
HIF1A (Hypoxia Inducible Factor 1 alpha, HIF1a, ARNT interacting Protein, HIF 1 alpha, HIF 1alpha, PASD8, MOP1) (MaxLight 550)
MBS6420343-01 0.1 mL

HIF1A (Hypoxia Inducible Factor 1 alpha, HIF1a, ARNT interacting Protein, HIF 1 alpha, HIF 1alpha, PASD8, MOP1) (MaxLight 550)

Sign In for Pricing
View Details
HIF1A (Hypoxia Inducible Factor 1 alpha, HIF1a, ARNT interacting Protein, HIF 1 alpha, HIF 1alpha, PASD8, MOP1) (MaxLight 550)
MBS6420343-02 5x 0.1 mL

HIF1A (Hypoxia Inducible Factor 1 alpha, HIF1a, ARNT interacting Protein, HIF 1 alpha, HIF 1alpha, PASD8, MOP1) (MaxLight 550)

Sign In for Pricing
View Details
ABCF1 Rabbit Polyclonal Antibody (Cy5.5)
orb1050209 100 µL

ABCF1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Lentiviral human GTF2IRD2B shRNA (UAS) - Lentiviral human GTF2IRD2B shRNA (UAS, RFP) (25)
GTR15121223 1 Vial

Lentiviral human GTF2IRD2B shRNA (UAS) - Lentiviral human GTF2IRD2B shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details