Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Rabbit Polyclonal Antibody (HRP)

CCS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD14 Protein Vector (Human) (pPM-C-HA)
PV057443 500 ng

SAMD14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
T7 High Yield RNA Synthesis Kit for Co-transcription (low dsRNA, with cap1 analog)
10635ES60 100 Tests

T7 High Yield RNA Synthesis Kit for Co-transcription (low dsRNA, with cap1 analog)

Sign In for Pricing
View Details
MYPOP AAV Vector (Human) (CMV)
31336101 1 µg

MYPOP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g43600 Polyclonal Antibody
MBS7146213 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g43600 Polyclonal Antibody

Sign In for Pricing
View Details
NativeExtract™ Human SLC1A5 Membrane Protein (Full length, Super Nanodisc)
S01YF-1023-KX427 10 μg

NativeExtract™ Human SLC1A5 Membrane Protein (Full length, Super Nanodisc)

Sign In for Pricing
View Details
Rnf6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4790605 3x 1.0 µg

Rnf6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details