Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM1 Rabbit Polyclonal Antibody (FITC)

CHRM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

M1, HM1, M1R

UniProt

P11229

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHRM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000729

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-conjugated Goat Anti-Human IgG Fab
HY-P89375 1 Each

FITC-conjugated Goat Anti-Human IgG Fab

Sign In for Pricing
View Details
Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)
MBS2026005-01 0.1 mL

Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)

Sign In for Pricing
View Details
Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)
MBS2026005-02 0.2 mL

Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)

Sign In for Pricing
View Details
Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)
MBS2026005-03 0.5 mL

Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)

Sign In for Pricing
View Details
Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)
MBS2026005-04 1 mL

Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)

Sign In for Pricing
View Details
Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)
MBS2026005-05 5 mL

Polyclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL)

Sign In for Pricing
View Details