Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hprt Rabbit Polyclonal Antibody (FITC)

Hprt Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hpr, HPGRT, Hprt1, C81579

UniProt

P00492

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abo Blocking Peptide
33R-3633 0.1 mg

Abo Blocking Peptide

Sign In for Pricing
View Details
PELP1 Rabbit mAb Antibody
orb1727617-01 50 µL

PELP1 Rabbit mAb Antibody

Sign In for Pricing
View Details
PELP1 Rabbit mAb Antibody
orb1727617-02 100 µL

PELP1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Il18r1 3'UTR GFP Stable Cell Line
TU256215 1.0 mL

Il18r1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
WDR45 Recombinant Protein (Rat)
RP237260 100 µg

WDR45 Recombinant Protein (Rat)

Sign In for Pricing
View Details
STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-phase Response Factor), APRF, FLJ20882, HIES, MGC16063) (FITC)
252157-FITC 100 µL

STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-phase Response Factor), APRF, FLJ20882, HIES, MGC16063) (FITC)

Sign In for Pricing
View Details