Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK1 Rabbit Polyclonal Antibody (FITC)

HK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HK, HKD, HKI, HXK1, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase

UniProt

P19367

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_277033

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKAP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
16211126 3x 1.0µg DNA

CKAP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
RC3H1, CT (RC3H1, KIAA2025, RNF198, Roquin, RING finger and C3H zinc finger protein 1, RING finger protein 198)
MBS6013479-01 0.2 mL

RC3H1, CT (RC3H1, KIAA2025, RNF198, Roquin, RING finger and C3H zinc finger protein 1, RING finger protein 198)

Sign In for Pricing
View Details
RC3H1, CT (RC3H1, KIAA2025, RNF198, Roquin, RING finger and C3H zinc finger protein 1, RING finger protein 198)
MBS6013479-02 5x 0.2 mL

RC3H1, CT (RC3H1, KIAA2025, RNF198, Roquin, RING finger and C3H zinc finger protein 1, RING finger protein 198)

Sign In for Pricing
View Details
Recombinant Human ILDR2 (C-6His)
C11F-10ug 10 µg

Recombinant Human ILDR2 (C-6His)

Sign In for Pricing
View Details
CIP29 Protein Vector (Human) (pPM-C-His)
PV009536 500 ng

CIP29 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Ethyl (1R,2S) -2- (boc-amino) cyclopentanecarboxylate
448569-01 25 mg

Ethyl (1R,2S) -2- (boc-amino) cyclopentanecarboxylate

Sign In for Pricing
View Details