Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK1 Rabbit Polyclonal Antibody (HRP)

HK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HK, HKD, HKI, HXK1, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase

UniProt

P19367

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_277033

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-01 20 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-02 100 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-03 500 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-04 1 mg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), CF740 conjugate, 0.1mg/mL
BNC742783-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2783), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL
BNC942597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details