Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK1 Rabbit Polyclonal Antibody (HRP)

HK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HK, HKD, HKI, HXK1, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase

UniProt

P19367

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_277033

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poll Rabbit Polyclonal Antibody
TA362896 100 µL

Poll Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Phenylbarbituric Acid
TRC-P319743-25MG 25 mg

5-Phenylbarbituric Acid

Sign In for Pricing
View Details
CFAP36 (NM_001282761) Human Tagged ORF Clone
RG237765 10 µg

CFAP36 (NM_001282761) Human Tagged ORF Clone

Sign In for Pricing
View Details
Horizontal Autoclave BAHZ-810-A
BAHZ-810-A 1 Unit

Horizontal Autoclave BAHZ-810-A

Sign In for Pricing
View Details
Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: OTI5C6]
CF810584 100 µg

Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: OTI5C6]

Sign In for Pricing
View Details
Taar9 Mouse Gene Knockout Kit (CRISPR)
KN517116 1 Kit

Taar9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details