Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANPEP Rabbit Polyclonal Antibody (HRP)

ANPEP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APN, CD13, LAP1, P150, PEPN, GP150

UniProt

P15144

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANPEP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP10 siRNA (Human)
MBS8240995-01 15 nmol

AQP10 siRNA (Human)

Sign In for Pricing
View Details
AQP10 siRNA (Human)
MBS8240995-02 30 nmol

AQP10 siRNA (Human)

Sign In for Pricing
View Details
AQP10 siRNA (Human)
MBS8240995-03 5x 30 nmol

AQP10 siRNA (Human)

Sign In for Pricing
View Details
NEK5 Protein Vector (Mouse) (pPB-C-His)
PV204882 500 ng

NEK5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 12 (CCDC12) ELISA Kit
MBS7236749-01 48 Well

Monkey Coiled-coil domain-containing protein 12 (CCDC12) ELISA Kit

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 12 (CCDC12) ELISA Kit
MBS7236749-02 96 Well

Monkey Coiled-coil domain-containing protein 12 (CCDC12) ELISA Kit

Sign In for Pricing
View Details