Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map2k1 Rabbit Polyclonal Antibody (HRP)

Map2k1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mek1, Prkm, MEKK1, MAPKK1, Prkmk1

UniProt

Q9JJE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
CK-bio-10543-01 48 Tests

Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
CK-bio-10543-02 96 Tests

Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
CK-bio-10543-03 5x 96 Tests

Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit
CK-bio-10543-04 10x 96 Tests

Human ATP-sensitive inward rectifier potassium channel 14, KCNJ14/Kir2.4 ELISA Kit

Sign In for Pricing
View Details
Anti-IL10RA Mouse Monoclonal Antibody [Clone ID: OTI1G10]
M03597 100 µL

Anti-IL10RA Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Lentiviral human H2AC1 shRNA (UAS) - Lentiviral human H2AC1 shRNA (UAS) (25)
GTR15307856 1 Vial

Lentiviral human H2AC1 shRNA (UAS) - Lentiviral human H2AC1 shRNA (UAS) (25)

Sign In for Pricing
View Details