Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFRA Rabbit Polyclonal Antibody (FITC)

PDGFRA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CD140A, PDGFR2, PDGFR-2

UniProt

P16234

Immunogen

The immunogen for Anti-PDGFRA antibody is: synthetic peptide directed towards the C-terminal region of Human PGFRA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDE

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 / CD135 (FLT3/2458), CF740 conjugate, 0.1mg/mL
BNC742458-500 1x 500 µL

Flt3 / CD135 (FLT3/2458), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (R346K, E484K, N501Y), His Tag (MALS verified)
SPD-C5221-1mg 1 mg

SARS-CoV-2 Spike RBD Protein (R346K, E484K, N501Y), His Tag (MALS verified)

Sign In for Pricing
View Details
Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F9]
TA501882AM 100 µL

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F9]

Sign In for Pricing
View Details
Vacuum Oven BOVA-5903
BOVA-5903 1 Unit

Vacuum Oven BOVA-5903

Sign In for Pricing
View Details
Mammaglobin A Recombinant Rabbit Monoclonal Antibody [PD00-74]
HA721202 100 µL

Mammaglobin A Recombinant Rabbit Monoclonal Antibody [PD00-74]

Sign In for Pricing
View Details
VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF488A conjugate, 0.1mg/mL
BNC882896-500 1x 500 µL

VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details