Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFRA Rabbit Polyclonal Antibody (HRP)

PDGFRA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD140A, PDGFR2, PDGFR-2

UniProt

P16234

Immunogen

The immunogen for Anti-PDGFRA antibody is: synthetic peptide directed towards the C-terminal region of Human PGFRA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDE

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN4 Antibody
C50504-01 50 μL

PIN4 Antibody

Sign In for Pricing
View Details
PIN4 Antibody
C50504-02 100 µL

PIN4 Antibody

Sign In for Pricing
View Details
Notch1, Extracellular Domain (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) (PE) discontinued
N5375-10-PE 100 µL

Notch1, Extracellular Domain (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) (PE) discontinued

Sign In for Pricing
View Details
BRAP Human Gene Knockout Kit (CRISPR)
KN417756 1 Kit

BRAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MCSF (Colony Stimulating Factor 1, Macrophage) Microsample ELISA Kit
orb2999096-01 48 Tests

Human MCSF (Colony Stimulating Factor 1, Macrophage) Microsample ELISA Kit

Sign In for Pricing
View Details
Human MCSF (Colony Stimulating Factor 1, Macrophage) Microsample ELISA Kit
orb2999096-02 96 Tests

Human MCSF (Colony Stimulating Factor 1, Macrophage) Microsample ELISA Kit

Sign In for Pricing
View Details