Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx7 Rabbit Polyclonal Antibody (FITC)

Stx7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Syn7, AI315064, AI317144, AW107239

UniProt

Q9JMJ6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A V/APOA5 Rabbit Polyclonal Antibody (Biotin)
orb2602339 100 µg

Apolipoprotein A V/APOA5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CRT0066101 dihydrochloride
S8366-1g 1 g

CRT0066101 dihydrochloride

Sign In for Pricing
View Details
Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)
TRV-0033435-01 20 µL

Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)

Sign In for Pricing
View Details
Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)
TRV-0033435-02 100 µL

Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)

Sign In for Pricing
View Details
Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)
TRV-0033435-03 200 µL

Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)

Sign In for Pricing
View Details
Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)
TRV-0033435-04 1 mL

Monoclonal Antibody to Chemokine (C-X-C motif) ligand 7 (CXCL7)

Sign In for Pricing
View Details