Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx7 Rabbit Polyclonal Antibody (HRP)

Stx7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Syn7, AI315064, AI317144, AW107239

UniProt

Q9JMJ6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal 14-3-3 beta Antibody [DyLight 488]
NBP2-98453G 0.1 mL

Rabbit Polyclonal 14-3-3 beta Antibody [DyLight 488]

Sign In for Pricing
View Details
Wdr37 AAV siRNA Pooled Vector
50326166 1.0 µg

Wdr37 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
METTL3 Protein Vector (Rat) (pPM-C-HA)
28416026 500 ng

METTL3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Dextrose Tryptone Agar
50223-01 100 g

Dextrose Tryptone Agar

Sign In for Pricing
View Details
Dextrose Tryptone Agar
50223-02 500 g

Dextrose Tryptone Agar

Sign In for Pricing
View Details
Mouse Monoclonal P2Y8 Antibody (1G5A2)
NBP2-61765 0.1 mL

Mouse Monoclonal P2Y8 Antibody (1G5A2)

Sign In for Pricing
View Details