Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX7 Rabbit Polyclonal Antibody (HRP)

STX7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O15400

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STX7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003560

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SIRT6 (Ser338) Rabbit Polyclonal Antibody (BF680)
orb1600793 100 µL

Phospho-SIRT6 (Ser338) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-01 1 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-02 5 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-03 100 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
Fas Ligand Rabbit Polyclonal Antibody (RBITC)
orb1054522 100 µL

Fas Ligand Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Rrp7a 3'UTR GFP Stable Cell Line
TU269743 1.0 mL

Rrp7a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details