Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83 Rabbit Polyclonal Antibody (HRP)

CD83 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BL11, HB15

UniProt

Q01151

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD83

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_004224

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10Z1 Antibody
DF5185-01 100 µL

OR10Z1 Antibody

Sign In for Pricing
View Details
OR10Z1 Antibody
DF5185-02 200 µL

OR10Z1 Antibody

Sign In for Pricing
View Details
Add1 ORF Vector (Mouse) (pORF)
ORF038162 1.0 µg DNA

Add1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-IGF1R Antibody Picoband® (Dylight488 Conjugate)
A00070-3-Dylight488 100 µg

Anti-IGF1R Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
CKMT2, NT (Creatine Kinase S-type, Mitochondrial, Sarcomeric Mitochondrial Creatine Kinase, S-MtCK, Basic-type Mitochondrial Creatine Kinase, Mib-CK) (APC) discontinued
C7910-21-APC 200 µL

CKMT2, NT (Creatine Kinase S-type, Mitochondrial, Sarcomeric Mitochondrial Creatine Kinase, S-MtCK, Basic-type Mitochondrial Creatine Kinase, Mib-CK) (APC) discontinued

Sign In for Pricing
View Details
MIBP1 Peptide
DF2398-BP 1 mg

MIBP1 Peptide

Sign In for Pricing
View Details