Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDA Rabbit Polyclonal Antibody (FITC)

CDA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDD

UniProt

P32320

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIBOPROTECT Hu RNase Inhibitor
BIBL0048-01 2000 U

RIBOPROTECT Hu RNase Inhibitor

Sign In for Pricing
View Details
RIBOPROTECT Hu RNase Inhibitor
BIBL0048-02 10000 U

RIBOPROTECT Hu RNase Inhibitor

Sign In for Pricing
View Details
Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit
MBS7264470-01 48 Well

Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit
MBS7264470-02 96 Well

Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit
MBS7264470-03 5x 96 Well

Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit
MBS7264470-04 10x 96 Well

Chicken Cat Eye Syndrome Critical Region Protein 2 ELISA Kit

Sign In for Pricing
View Details