Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSS2 Rabbit Polyclonal Antibody (Biotin)

ACSS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ACS, ACSA, ACAS2, ACECS, AceCS1, dJ1161H23.1

UniProt

Q4G0E8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gldn / Gliomedin ELISA Kit
MBS2905800-01 48 Well

Mouse Gldn / Gliomedin ELISA Kit

Sign In for Pricing
View Details
Mouse Gldn / Gliomedin ELISA Kit
MBS2905800-02 96 Well

Mouse Gldn / Gliomedin ELISA Kit

Sign In for Pricing
View Details
Mouse Gldn / Gliomedin ELISA Kit
MBS2905800-03 5x 96 Well

Mouse Gldn / Gliomedin ELISA Kit

Sign In for Pricing
View Details
Mouse Gldn / Gliomedin ELISA Kit
MBS2905800-04 10x 96 Well

Mouse Gldn / Gliomedin ELISA Kit

Sign In for Pricing
View Details
Monoclonal antibody to dengue NS1, conjugate for rapid test
orb2309055 1 mg

Monoclonal antibody to dengue NS1, conjugate for rapid test

Sign In for Pricing
View Details
Albumin Rabbit mAb
E45R12506N-100 100 µL

Albumin Rabbit mAb

Sign In for Pricing
View Details