Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSS2 Rabbit Polyclonal Antibody (HRP)

ACSS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACS, ACSA, ACAS2, ACECS, AceCS1, dJ1161H23.1

UniProt

Q9NR19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001070020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il1ra Antibody / Interleukin-1 receptor antagonist / Il1rn
RQ6425 100 µg

Il1ra Antibody / Interleukin-1 receptor antagonist / Il1rn

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2D3
MBS142484-01 0.002 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2D3

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2D3
MBS142484-02 0.01 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2D3

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2D3
MBS142484-03 1 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2D3

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2D3
MBS142484-04 5x 1 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2D3

Sign In for Pricing
View Details
Human HEV-IgG (hepatitis E virus-Immunoglobulin M) ELISA Kit
MBS7612297-01 48 Strip Well

Human HEV-IgG (hepatitis E virus-Immunoglobulin M) ELISA Kit

Sign In for Pricing
View Details