Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk1 Rabbit Polyclonal Antibody (HRP)

Mapk1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERK, MAP, Prk, Erk2, p42m, MAPK2, PRKM2, Prkm1, C78273, p41mapk, p42mapk, AA407128, AU018647, 9030612K14Rik

UniProt

P63085

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mapk1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucobrassicanapin potassium salt
VJA55058-01 10 mg

Glucobrassicanapin potassium salt

Sign In for Pricing
View Details
Glucobrassicanapin potassium salt
VJA55058-02 25 mg

Glucobrassicanapin potassium salt

Sign In for Pricing
View Details
Glucobrassicanapin potassium salt
VJA55058-03 50 mg

Glucobrassicanapin potassium salt

Sign In for Pricing
View Details
Glucobrassicanapin potassium salt
VJA55058-04 100 mg

Glucobrassicanapin potassium salt

Sign In for Pricing
View Details
Glucobrassicanapin potassium salt
VJA55058-05 250 mg

Glucobrassicanapin potassium salt

Sign In for Pricing
View Details
Sema3f sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6415206 1.0 µg DNA

Sema3f sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details