Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk1 Rabbit Polyclonal Antibody (HRP)

Mapk1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERK, MAP, Prk, Erk2, p42m, MAPK2, PRKM2, Prkm1, C78273, p41mapk, p42mapk, AA407128, AU018647, 9030612K14Rik

UniProt

P63085

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mapk1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPLOC4 Protein Lysate (Mouse) with C-HA Tag
32068035 100 µg

NPLOC4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Aoah Mouse qPCR Primer Pair (NM_012054)
MP200320 200 Reactions

Aoah Mouse qPCR Primer Pair (NM_012054)

Sign In for Pricing
View Details
GYS2 Protein Vector (Mouse) (pPB-C-His)
PV187474 500 ng

GYS2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Uromodulin (UMOD) ELISA kit
QY-E10104 96 Tests

Rat Uromodulin (UMOD) ELISA kit

Sign In for Pricing
View Details
Phospho-BACE(S498) Antibody Blocking peptide
MBS9224989-01 0.5 mg

Phospho-BACE(S498) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-BACE(S498) Antibody Blocking peptide
MBS9224989-02 5x 0.5 mg

Phospho-BACE(S498) Antibody Blocking peptide

Sign In for Pricing
View Details