Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prom1 Rabbit Polyclonal Antibody (Biotin)

Prom1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P, Pro, AC13, Prom, AC133, CD133, Prom-1, Proml1, 4932416E19Rik

UniProt

O54990

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TATA binding protein TBP Antibody [Alexa Fluor 700]
NBP2-98905AF700 0.1 mL

Rabbit Polyclonal TATA binding protein TBP Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Beta-arrestin 2 Rabbit Polyclonal Antibody (BF594)
orb1975256 100 µL

Beta-arrestin 2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Recombinant Mouse TNFSF11 protein, N-His tag
IMP-1226 10 µg

Recombinant Mouse TNFSF11 protein, N-His tag

Sign In for Pricing
View Details
Rabbit Monoclonal Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (029) [Allophycocyanin]
NBP2-89949APC 0.1 mL

Rabbit Monoclonal Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (029) [Allophycocyanin]

Sign In for Pricing
View Details
LSM10 Antibody, HRP conjugated
CSB-PA836169LB01HU-01 50 µg

LSM10 Antibody, HRP conjugated

Sign In for Pricing
View Details
LSM10 Antibody, HRP conjugated
CSB-PA836169LB01HU-02 100 µg

LSM10 Antibody, HRP conjugated

Sign In for Pricing
View Details