Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prom1 Rabbit Polyclonal Antibody (HRP)

Prom1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P, Pro, AC13, Prom, AC133, CD133, Prom-1, Proml1, 4932416E19Rik

UniProt

O54990

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF488A conjugate, 0.1mg/mL
BNC882466-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Human HLA-DQ Antibody[1a3]
AN00421D-01 20 Tests

PE Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details
PE Anti-Human HLA-DQ Antibody[1a3]
AN00421D-02 100 Tests

PE Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details
PE Anti-Human HLA-DQ Antibody[1a3]
AN00421D-03 2x 100 Tests

PE Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR560681 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL
BNC682040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details