Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROM1 Rabbit Polyclonal Antibody (HRP)

PROM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP41, AC133, CD133, MCDR2, STGD4, CORD12, PROML1, MSTP061

UniProt

O43490

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trpm2 Mouse Gene Knockout Kit (CRISPR)
KN318299LP 1 Kit

Trpm2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NeuN (RBFOX3) Mouse Monoclonal Antibody [Clone ID: A60]
AM10122SU-N 1 mL

NeuN (RBFOX3) Mouse Monoclonal Antibody [Clone ID: A60]

Sign In for Pricing
View Details
UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D3]
TA800071BM 100 µL

UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806540 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
BAT3 (BAG6) (NM_080703) Human Over-expression Lysate
LY403316 100 µg

BAT3 (BAG6) (NM_080703) Human Over-expression Lysate

Sign In for Pricing
View Details
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF405S conjugate, 0.1mg/mL
BNC042251-100 1x 100 µL

8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details