Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5a Rabbit Polyclonal Antibody (FITC)

Rab5a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI663973, AU021172, nnyRab5a, 2410015H04Rik

UniProt

Q9CQD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_080163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPSA (NAP1, NAPA, Napsin-A, Aspartyl Protease 4, ASP4, Asp 4, Napsin-1, TA01/TA02) (PE)
130147-PE 100 µL

NAPSA (NAP1, NAPA, Napsin-A, Aspartyl Protease 4, ASP4, Asp 4, Napsin-1, TA01/TA02) (PE)

Sign In for Pricing
View Details
RNF165 Double Nickase Plasmid (m)
sc-432560-NIC 20 µg

RNF165 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
GATSL2 Protein Vector (Mouse) (pPM-C-HA)
21340024 500 ng

GATSL2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Cat Que virus MAOA Protein, N-His
MBS1588111-01 0.1 mg

Recombinant Cat Que virus MAOA Protein, N-His

Sign In for Pricing
View Details
Recombinant Cat Que virus MAOA Protein, N-His
MBS1588111-02 1 mg

Recombinant Cat Que virus MAOA Protein, N-His

Sign In for Pricing
View Details
Recombinant Cat Que virus MAOA Protein, N-His
MBS1588111-03 5x 1 mg

Recombinant Cat Que virus MAOA Protein, N-His

Sign In for Pricing
View Details