Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zap70 Rabbit Polyclonal Antibody (Biotin)

Zap70 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, Srk, mur, ZAP-, mrtle, ZAP-70

UniProt

P43404

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF1 ELISA Kit (Human) (OKAN06264)
OKAN06264 96 Well

C1QTNF1 ELISA Kit (Human) (OKAN06264)

Sign In for Pricing
View Details
IGFBP3 Mouse Monoclonal Antibody
orb2959018-01 50 µg

IGFBP3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Mouse Monoclonal Antibody
orb2959018-02 100 µg

IGFBP3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Mouse Monoclonal Antibody
orb2959018-03 1 mg

IGFBP3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse H3c14 shRNA (UAS) - Lentiviral mouse H3c14 shRNA (UAS, RFP) plasmid
GTR15233869 1 Vial

Lentiviral mouse H3c14 shRNA (UAS) - Lentiviral mouse H3c14 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Prolyl 4-hydroxylase Beta Subunit (P4HB) Rabbit anti-Human Polyclonal Antibody
GWB-EF7A8F 0.05 mL

Prolyl 4-hydroxylase Beta Subunit (P4HB) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details