Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zap70 Rabbit Polyclonal Antibody (FITC)

Zap70 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S, Srk, mur, ZAP-, mrtle, ZAP-70

UniProt

P43404

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholamban (PLN) ELISA Kit
EK16170 48 Tests

Human Phospholamban (PLN) ELISA Kit

Sign In for Pricing
View Details
CA X HDR Plasmid (m)
sc-428391-HDR 20 µg

CA X HDR Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human C9orf163 shRNA (UAS) - Lentiviral human C9orf163 shRNA (UAS, GFP) plasmid
GTR15314617 1 Vial

Lentiviral human C9orf163 shRNA (UAS) - Lentiviral human C9orf163 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal HSD17B6 Antibody [DyLight 488]
NBP2-99211G 0.1 mL

Rabbit Polyclonal HSD17B6 Antibody [DyLight 488]

Sign In for Pricing
View Details
Fut7-set siRNA/shRNA/RNAi Lentivector (Rat)
21083096 4x 500 ng

Fut7-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Recombinant Mouse MIF / Macrophage Migration Inhibitory Factor, Animal Free & Carrier Free
C-CYP239-20ug 20 µg

Recombinant Mouse MIF / Macrophage Migration Inhibitory Factor, Animal Free & Carrier Free

Sign In for Pricing
View Details