Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zap70 Rabbit Polyclonal Antibody (HRP)

Zap70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Srk, mur, ZAP-, mrtle, ZAP-70

UniProt

P43404

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGDHL (NM_018245) Human Recombinant Protein
TP305225 20 µg

OGDHL (NM_018245) Human Recombinant Protein

Sign In for Pricing
View Details
6-Alpha-D-Glucopyranosyl Maltotriose Tridecaacetate
TRC-G419135-5MG 5 mg

6-Alpha-D-Glucopyranosyl Maltotriose Tridecaacetate

Sign In for Pricing
View Details
FITC Anti-Human CD6 Antibody[HI210]
E-AB-F1314C-01 20 Tests

FITC Anti-Human CD6 Antibody[HI210]

Sign In for Pricing
View Details
FITC Anti-Human CD6 Antibody[HI210]
E-AB-F1314C-02 100 Tests

FITC Anti-Human CD6 Antibody[HI210]

Sign In for Pricing
View Details
FITC Anti-Human CD6 Antibody[HI210]
E-AB-F1314C-03 2x 100 Tests

FITC Anti-Human CD6 Antibody[HI210]

Sign In for Pricing
View Details
Arpin Mouse Gene Knockout Kit (CRISPR)
KN500276 1 Kit

Arpin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details